PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 340aa    MW: 38123.3 Da    PI: 5.9813
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21908.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.4e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
       KHN21908.1 19 KGLWSPEEDDKLMNYMLNSGQGCWSDVARNAGLQRCGKSCRLRWINYL 66
                     678*******************************************97 PP

2Myb_DNA-binding51.81.8e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+e++++++ +lG++ W+ Ia++++ gRt++++k++w++
       KHN21908.1  72 RGAFSPQEEEIIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-231469IPR009057Homeodomain-like
PROSITE profilePS5129415.0891466IPR017930Myb domain
SuperFamilySSF466891.68E-2717113IPR009057Homeodomain-like
SMARTSM007172.4E-91868IPR001005SANT/Myb domain
PfamPF002491.3E-121966IPR001005SANT/Myb domain
CDDcd001675.10E-82266No hitNo description
PROSITE profilePS5129425.81767121IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2670122IPR009057Homeodomain-like
SMARTSM007177.2E-1671119IPR001005SANT/Myb domain
PfamPF002494.1E-1572115IPR001005SANT/Myb domain
CDDcd001672.12E-1174114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MRKPEVSGKN NNINNKLRKG LWSPEEDDKL MNYMLNSGQG CWSDVARNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE EIIIHLHSLL GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR  120
LKNLSSNTSP NGSESSYEPN NKDLNMAGFT TSNTQQNQQH ADFMPMFNSS SQSPSMHATT  180
VLNSIIDRLP MLEHGLNMTS SGGFFNSKGP CFSSSQSGVD NNKGFYLENG GVFGSVNIGA  240
EGDMYVPPLE SVSTTSDHYN LKLESTCNTD TNNSNYFDDI NSIILNNCNI NNSNNIKRAE  300
NRAGGVENLF QEELTIGEWD LEELMKDVSS FPFLDFSKIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-281312121128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006590966.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0B2QPU70.0A0A0B2QPU7_GLYSO; Transcription factor MYB46
TrEMBLK7LPK70.0K7LPK7_SOYBN; Uncharacterized protein
STRINGGLYMA11G14200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-72myb domain protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]